DuolinkaeinsSitu BIOSCIENCE The protocols in this manual are compatible with all Duolink In Situ PLA probes Duolink In Situ Detection Reagents Green Art no 92014 Orange Art no 92007 Red Art no 92008 and Far Red Art no 92013 Table of content T INTRODUCTION sad atra E tet 4 2 PRINCIPLE OF THE ASSAY niat te oerte etes 5 8 APPLICATIONS dae ete 6 3 1 Detect and quantify protein interactions 6 3 2 Detect and quantify protein mod
ORTEC GammaVision Report Writer for Microsoft Windows 7 and XP SP3 A44 BW Software User s Manual Software Version 3 1 Printed in U S A ORTEC Part No 774810 0914 Manual Revision K Advanced Measurement Technology Inc a k a ORTEC a subsidiary of AMETEK Inc WARRANTY ORTEC DISCLAIMS ALL WARRANTIES OF ANY KIND EITHER EXPRESSED OR IMPLIED INCLUDING BUT NOT LIMITED TO THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE NOT
4 Assembly Technologies Alpha Controller User Manual v3 1 Important Safeguards For your protection please read these instructions completely and keep this manual for future reference Carefully observe and comply with all warnings cautions and instructions placed on the equipment or described in this manual THE STANLEY WORKS ALL RIGHTS RESERVED www stanleyAssembly com QA Alpha V 3 1 0608 User Manual Contents Genting RETE 1 11 Warnings and Ca
Chitu V3 1 User Manual Compiler Date 15 08 2014 Reviewer Davi Date 15 08 2014 Approver Sam Lin Date 15 08 2014 Copyright Declaration The manual is only used for the purchaser Any part of this manual shall not be reproduced or disseminated for any purpose or in any way such as electronic format and mechanical means or other methods including photocopy and record without written authorization of CBD Tech Technical Supports Please contact us if
Universidad Complutense de Madrid Datalog Educational System Datalog Educational System V3 10 User s Manual Fernando S enz P rez Grupo de Programaci n Declarativa GPD Departamento de Ingenier a del Software e Inteligencia Artificial DISIA Universidad Complutense de Madrid UCM January 21st 2015 Fernando S enz P rez 1 274 Universidad Complutense de Madrid Datalog Educational System Copyright C 2004 2015 Fernando S enz P rez
DHL CONNECT VERSION 3 1 Click on DHL Connect to begin DHL Connect Express shipping made easy Shipment Shipment Logs Global Track Addresses Reports Manager Prepare a Access a history of Track shipments by Keep an on line Aew and print E mail OHL and shipment book a all shipment date reference or air shipping address reports to help Order Supplies pickup and information way bill number book manage the on line complete Customs shipping process documents DHL Co
Expression Lighting control systems User Manual Supplement Version 3 1 This document supplements the version 3 03 user manuals previously released for Expression Express Insight and related lighting control systems Inside you will find explanations of the new features found in software release 3 1 for these control systems This information is also integrated with previously released information in the version 3 1 user manuals for Expression family products Contents
Encoder Firmware A1D 220 V3 13 16 AC User s Manual DA acti www acti com Table of Contents I INSTALLATION 1 1 Minimum System Requirements 1 2 Preparation before setup 1 2 1 Setup your PC network 1 3 Configuring the IP device 1 3 1 1 2 2 1 3 3 1 3 4 L33 1 3 6 1 3 7 1 3 8 1 3 9 1 3 10 1 3 11 1 25 12 1 3 13 1 3 14 1 3 15 1 3 16 LES 1 3 18 1 3 19 1 3 20 1 3 21 1 95 22 1 95 23 Video Display PTZ PTZ Camera only Host Setting WAN Setti
XJ98 APH YSE A Flashlite 386Ex User s Manual JK microsystems Unless otherwise noted this document and the information herein disclosed are proprietary to JK microsystems Inc Any person or entity to whom this document is furnished or having possession thereof by acceptance assumes custody thereof and agrees that the document is given in confidence and will not be copied or reproduced in whole or in part to meet the purposes for which it was delivered The information
Format Convert Software User Manual V3 1 Contents Chapter 1 SO mw are ASUS N laos 3 Welcome ie race esse ai ede eee 3 ORG POM NAG ae cae reco ee ae ee NS Nee Renee 3 CPAP ET Vnmstall rn nee ee een nee ende 5 EOL 5 Caer Oo al Op E On ee le ERC 6 A sende a 6 Format Select A ee A ee Reese 6 Convert Tilo Informa losen ee ua id cial 6 Pr vie WOU AAA a see ee O 7 Conver Parime er Conn an reset do thie a RN ula i i Gaia esa umeaeual hee aetna bad sedan ahahaha da 8 AO o o REO
User Guide English ServerView Suite ServerView Virtual IO Manager V3 1 User Guide Edition October 2012 Comments Suggestions Corrections The User Documentation Department would like to know your opinion of this manual Your feedback helps us optimize our documentation to suit your individual needs Feel free to send us your comments by e mail to manuals ts fujitsu com Certified documentation according to DIN EN ISO 9001 2008 To ensure a consistently hig
GuideTRAX V3 1 HL User Manual Software Version 3 1 Part Number 1 1254 Revision A Issue Date March 2006 Copyright Notice All rights reserved No part of this publication may be reproduced stored in a retrieval system or transmitted in any form or by any means electronic mechanical photocopying recording or otherwise without the prior written permission of RINEX Technology Disclaimer No liability is assumed with respect to the use of the information co
GuideTRAX V3 1 HR User Manual Software Version 3 1 Part Number 1 1256 Revision A Issue Date March 2006 Copyright Notice All rights reserved No part of this publication may be reproduced stored in a retrieval system or transmitted in any form or by any means electronic mechanical photocopying recording or otherwise without the prior written permission of RINEX Technology Disclaimer No liability is assumed with respect to the use of the information co
Hardware User Manual EVAL BF5xx Board V3 1 V3 0 PRELIMINARY www tinyboards com Maximum Power at Minimum Size Contact Bluetechnix Mechatronische Systeme GmbH Waidhausenstr 3 19 A 1140 Vienna AUSTRIA EUROPE office Obluetechnix at http www bluetechnix com Document No 100 2205 3 1 Version 4 2006 12 30 Blackfin EVAL BF5xx Hardware User Manual Table of Contents BLACKFIN Products a ed 1 A ie ee een a ies NR 3 1 1 e een td i te lo dl ede
I gt Intelligent Integration Interface Intelligent Integration Interface User Manual Clinical System Integration for Numed Healthcare Products Revision 3 1 NUMED HEALTHC AR E Supply amp Installation gt Training gt Support Alliance House Roman Ridge Road Sheffield S9 1GB Tel 0114 2433896 Email sales numed co uk www numed co uk Copyright Notice Copyright o 2013 2015 Numed Healthcare All rights reserved No part of the do
iPoint RDVR v3 1 Server User Manua iPoint RDVR v3 1 Server USER MANUAL 556 1 of 40 iPoint RDVR v3 1 Server User Manual 1 3 4 5 Table of Contents GENERAL SYSTEM 5 1 1 System 5 1 2 Sy Stern Main EUDCLUOD decido etin cid equos d dme 5 1 3 DD oot eot E E S 5 IA PESA TS 6 1 5 Parts Contre taO
Iste ISTE Classroom Observation Tool mresearche ICOT v3 1 User Manual evaluation Talbot Bielefeldt Senior Research Associate ISTE Research amp Evaluation August 2012 Contents POOULING GON ae 1 ICOT Assumptions 1 History 2 Changes in ICOT v3 1 2 Security Risk 2 Problems and Bugs 2 Recording ICOT Datta ccccccccccccsececeecseeeeeeeeseeeseeteneeseetaneeaes 3 Control Buttons 3 Setting 4 Teacher Roles Student Groupings Learning Activities 4 Ne
Jevtrace v3 12b amp jevtrace dendogram c jevtrace_test MLE_tcoffee ph lt c jevtrace_test MLE_tcoffee aln 30 40 50 MYKSVETILVDIPTIRPHKLSVTTMQTOTI Meme MIATGITIDRIDTLLVDVPTVRPHKLSVATMNCQ 7 MIATGITIDRIDTLLVDVPTVRPHKLSVATMNCQ MIATPVKIESVETILVDVPTIRPHRLSVATMNCQTTI MIATPVKIESVETILVELPTIRPHRLSVATMNCOTL MIATPVKIESVETILVDVPTIRPHRLSVATMNC OTL MIPSAVQIQAVETILVDVPTIRPHRLSVATMNC ne MTALANPOILGIETILLDLPTIRPHVLAMATMHAQT MNAOITSVETVLVDLPTIRAHQLAMATMQQQTI MNAQITSV
MT box PRO test point adapter NOKIA BB5 unlock user manual v3 1 Supported phones 3109c 6126 e 63006 E62 3110c 6131 6630 E65 3250 6133 6680 e N70 5200 6136 6681 e N71 5200b 6151 7370 e N72 5300 e 6233 7373 e N73 5300b e 6234 7390 e N75 5500 6270 8600 e N80 6085 6280 E50 e N91 6086 6288 E60 e N93 6125 6300 E61 e N95 ba H L The box package The box package contain MT box PRO test point adapter T
Network Digital Signage Player User Manual v3 1 V3 0 06198 1 4 26 2010 Table of Contents I Introduction II Board Spec and Components III Evaluation Kit IV Playlist and Operation V Client Device Setup Client board Installation Client Main Menu Client Setup Screen Remote Control Key Definition Scrolling Text Format Mn BON VI CAT Server Software CAT exe Tools Tab Account Sever Utility Setup Client Utility Setup Play
g powered by amp YAMAHA NXAMP4x1 NXANMP4x4 Powered TDcontrollers NEXO powered by YAMAHA EEEngine Digital Patching Unit Oo Oc SPK8 0 User Manual v3 1 LOAD3_23 FCC INFORMATION U S A 1 IMPORTANT NOTICE DO NOT MODIFY THIS UNIT This product when installed as indicated in the instructions contained in this manual meets FCC requirements Modifications no
Omnia Goldilocks would approve It s just right Installation amp User s Guide Written by Jim Kuzman Telos Alliance Technical Writer V3 14 50 and Later January 2015 Table of Contents Table of Contents Getting the Most from This Manual Page 3 Chapter 1 The Omnia 7 Story Page 5 Chapter 2 Quick Startup Guide Page 8 Chapter 3 General Processing Advice Page 12 Chapter 4 Home Screen amp User Interface Page 15 Chapter 5 Reading the Processing Meters Page 1
USER GUIDE ProtoArray Prospector v5 2 3 Publication Number MANO0013674 Revision A 0 For Research Use Only Not for use in diagnostic procedures novex oy Life technologies technologies For Research Use Only Not for use in diagnostic procedures Information in this document is subject to change without notice DISCLAIMER TO THE EXTENT ALLOWED BY LAW LIFE TECHNOLOGIES AND OR ITS AFFILIATE S WILL NOT BE LIABLE FOR SPECIAL INCIDENTAL INDIRECT PUNITIVE MULT
SENSE THE FUTURE eee SmartSoft v3 1 User Manual Document Ref 3100 3008 B Document Date 24th May 2013 Approved by This information herein is the property of Smart Fibres Ltd and is to be held strictly in confidence by the recipient No copy is to be made without the written permission of Smart Fibres Ltd Disclosures of any of the information herein is to be made only to such persons who need such information during the course of their engagement or employment at S
User Manual for the Tensiometer tyoes SWT4 amp SWT4R SWT4 UM 3 1 Delta T Devices Ltd Notices Copyright All rights reserved Under the copyright laws this manual may not be copied in whole or in part without the written consent of Delta T Devices Ltd and UMS GmbH Under the law copying includes translation into another language Copyright 2009 Delta T Devices Limited 2009 UMS GmbH CE conformity The sensors described in this document ar
TVOC Instrument User Manual V3 1 ppm WARNING DO NOT OPEN WHEN ENERGISED 12 G EEx ia tic T4 BaseefaO5ATEX0277 20 C s Tas 50 C II 3 G ExnNA IIC T4 lonScience09849 ECEx BAS 06 0057 Ex ia IIC T4 U S Patent No 7 046 012 EP 1474681 Other patents pending Refer to manual before Installation ION SCIENCE LTD The Way Fowimere Cambs SG8 7U N 1743 208503 FAX 44 0 1763 208814 www ionscience com j PINKY YES RK n 3 4 EINAR PPLE Hy EEGEN
IH ALE IC ROS YS TEM S UMC32 M DIY USB MIDI Controller USER MANUAL Firmware v3 1 0 Hardware v1 1 2008 2011 Hale Microsystems LLC All Rights Reserved UMC32 DIY USB MIDI User Manual 2 H A L MICROSYSTEMS Product Description The UMC32 M is an OEM DIY product that allows Electronic Musicians Multimedia Artists and Experimenters the ability to create custom user interfaces to control any software application that supports the MIDI protocol The UMC32
J SISMO SOLUCIONES Plug amp Fly 737NG CLOCK V3 1 mot CR d SN 129 50 en a Ka a gel gese ae nn USER MANUAL MAN SGGSRR 09 003 November 2012 02 Flight Simulators Gs www sismo soluciones com GO SISMO SOLUCIONES ee Sl INDEX 1 IT 3 2 alga e Dene rs indio 3 3 E E a A io PO aan E OI eee E 4 4 Vu ee E 5 5 As A 6 5 1 TIME DATE Fe A 6 7 6 1 Sieg H er E A A ER 10 6 2 A e 11 RU 12 7 1 AP AP ee 13 SU 14 02 USER MANUAL
MA299 024 00 00 Doc ver 1 7 M16C v3 1 C Compiler Assembler Linker User s Manual A publication of Altium BV Documentation Department Copyright O 2002 2005 Altium BV All rights reserved Reproduction in whole or part is prohibited without the written consent of the copyright owner TASKING is a brand name of Altium Limited The following trademarks are acknowledged FLEXlm is a registered trademark of Macrovision Corporation Intel is a trademark of In
HIKVISION LT his me IVMS 5200 Control Client User Manual UD 6L0202D1650A01 User Manual of iVMS 5200 Control Client Hikvision iVMS 5200 Control Client User Manual This manual as well as the software described in it is furnished under license and may be used or copied only in accordance with the terms of such license The content of this manual is furnished for informational use only is subject to change without notice and should not be construed as a c
To change folders press 2 from the phone key Quick USB Start Guide board and the screen will show you the folder names you can scroll with SEEK and SEEK Universal Media Interface UMI Po The Universal Media Interface UMI it is de signed to provide USB portable device media in terconnect to the in ar head unit display AUDIO Features The USB media player is available by selecting To select a folder press and hold SEEK if there e iP
User Manual v1 1 for DVA v3 12 Marco Lippi Stefano Melacci Department of Information Engineering and Mathematical Sciences University of Siena dva diism unisi it September 29 2014 1 How to run DVA getting started To run DVA the command line syntax is the following dva lt source gt m lt model dir gt options where source is the input to be processed which can be either e a video file e a folder containing a collection of frames e a device identifier
Electric Paper EvaSys 4 Automated Document So V3 1 Rev 1 EvaSys 4 Automated Course Evaluation Feedback System User Manual VividForms V3 1 Copyright 2001 2007 Electric Paper GmbH Subject to change without notice Electric Paper GmbH Konrad Zuse Allee 13 21337 LUneburg Germany Electric Paper EvaSys ii Automated Document Solutions Table of Contents 1 OVERVIEW ON THE THREE VIVIDFORMS COMPONENTS cscescescescesceccscescesc
US ourens INC impact Online Version 3 1 15 External User s Manual Table of Contents Table OF COMEM S ua tana sn i NVOdUCUOM irion i aa i Nt 1 Neca an A A E AEA 2 FOOL VOUE Password sieka E a 2 MY ACCOUN ania added 3 ACCOUNEINOMA UO isisisi a a dad 3 Change i PaSSWOrT ui E E adel 3 Compa Name cuesta E teow se ea dito O E E A 3 PRONO e E E E r E 4 a T E EE E EEI A sei la Os toad sade 4 Address tand Address teamon ea eee sia sigan E O E A 4 CM EE IAEE S E
User Manual Version 9 1 veesoe VMT 5013 ads tec GmbH Raiffeisenstr 14 D 70771 Leinfelden Echterdingen Tel 49 0 711 45894 0 Fax 49 0 711 45894 990 mailbox ads tec com http www ads tec com User Manual VMT 5015 V3 1 Et Eiter Copyright ads tec GmbH Raiffeisenstr 14 D 70771 Leinfelden Echterdingen Germany gt ads tec GmbH e Raiffeisenstr 14 e 70771 Leinfelden Echterdingen Te Pier User Manual VMT 5015 V3 1 IN
ZEUS REFERRALS V3 1 SERVICE PROVIDER USER MANUAL Z E US Service Provider User Manual REFERRALS Contents Service Provider OVEIVI Wars nara 3 O A E o ES RO AA OET E 3 2 POW Alacan da 3 2 1 BVO INS ge oo EU oo o atm serscees 3 2 2 AAA e po 4 AA VEW RETOS dos 4 2 3 A A eet eno erase ead ance oa poles nen aanaa E E E E E 4 2 4 A e o o A e o O o 5 2 4 1 A A A A 5 2 4 2 VVC ACCOUN a eE E 8 2 4 3 A nn E PP na 9 2 5 o o e e o A 10 2 6 Md o UE O o 11 26 1 o