| # | Img | Title | Type | Language | VIEW | |||||||||
| 1. |
|
1 User`s Manual for Star Chart Plot Program Prepared by Toshimi User s Manual for Star Chart Plot Program Prepared by Toshimi Taki March 26 2008 1 Introduction Star Chart Plot Program is designed for making star charts to be printed on paper It was used to make Taki s Star Atlas Taki s 8 5 Magnitude Star Atlas and Atlas of Double Stars The program and the example data file for Atlas of Double Stars are available in my homepage http www asahi net or jp zs3t tk This manual shows instruction to use St |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 2. |
|
22in ANTIQUED CHIMINEA Assembly Instructions and User`s Manual Assembly Instructions and User s Manual 22in ANTIQUED CHIMINEA FSMVPT6002 READ INSTRUCTION MANUAL BEFORE ATTEMPTING TO ASSEMBLE OR OPERATE THIS PRODUCT Adult assembly required Keep the screws and parts out of reach of children For customer service please call 1 888 922 2336 or E mail customer service academy com Business hours Monday through Friday 7 00am to 10 00pm Sunday 9 00am to 8 00pm Central standard Time Made in China Table Of Contents |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 3. |
|
Aiphone CHIME TONE IBG-2AD user manual AIPHONE 833239 1BG 2AD1 1085 NA CHIME TONE INTERCOM MODELS IBG 2AD master station DC 12V IBG 2CD sub station j INSTRUCTIONS NAMES AND FUNCTIONS T Handset 2 Chime volume control 3 Room station call button LED for door station call in x 2 5 Door station selector button x 2 Door release button FEATURES AND SPECIFICATIONS One master system which may include up to two door stations and two room subs Melodic two stro |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 4. |
|
Aiphone CHIME TONE IBG-2CD user manual AIPHONE 833239 1BG 2AD1 1085 NA CHIME TONE INTERCOM MODELS IBG 2AD master station DC 12V IBG 2CD sub station j INSTRUCTIONS NAMES AND FUNCTIONS T Handset 2 Chime volume control 3 Room station call button LED for door station call in x 2 5 Door station selector button x 2 Door release button FEATURES AND SPECIFICATIONS One master system which may include up to two door stations and two room subs Melodic two stro |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 5. |
|
Aiphone CHIME TONE INTERCOM TC-MC user manual 830300 1087 AIPHONE CHIME tone intercom INTERPHONE A VEC CARILLON INTERCOMUNICADOR CON CARILLON GEGENSPRECHANLAGE MIT GLOCKENKLANG MODEL MODELE MODELO MODELL Set Set Juego Satz INSTRUCTIONS TC DB NAMES amp FUNCTIONS NOMS ET FONCTIONS NOMBRES V FUNCIONES NAMEN UND FUNKTIONEN TC MG MASTER STATION POSTE MAITRE APARATO PRINCIPAL HAUPTSTATION CD Handset CO Combine 1 j Mango tefefonico Horer Hook |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 6. |
|
Aiphone DUAL MASTER CHIMECOM SYSTEM C-123LW user manual 90102 0610 OAIPHONE C 123LW Supplemental Instructions Dual Master ChimeCom System REFER TO INSTALLATION MANUAL INSIDE C 123L A BOX FOR STANDARD INSTALLATION INFORMATION The C 123LW Dual Master ChimeCom set provides chime communication and door release for one door and two inside locations This supplemental instruction manual addresses many of the additional functions and modifications for the Chime Com system including installation and troubleshooting information |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 7. |
|
Archimede User Manual rev.2_EN e oe Archimede Datalogger Archimede Datalogger gt sc del E 11 23 4812 e7eso sisoea ad User Manual Archimede Portable Dataloggers User Manual INDEX NOTE ON SYSTEM UTILIZATION WASTE DISPOSAL SYMBOLOGY IDENTIFICATION PLATE DL OVERVIEW INTRODUCTION LEONARDO OCDL200UNO0 new LEONARDO 0CDL400N000 GALILEO OCDL100VWO0 ARCHIMEDE OCDL300INCL ACCESSORIES and SPARE PARTS DL STORAGE AND TRANSPORT BATTERIES Battery charger Internal temp |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 8. |
|
ArchimedesMB User Manual ArchimedesMB User Manual 2006 www naval architecture co uk Introduction ArchimedesMB Free for Personal Use by John A MacSween ArchimedesMB may be freely copied and distributed for personal use only If it is commercially used then it MUST be registered In this way you can guarantee the continued developement of the software We hope you like the software and we always appreciate feedback on what we can do to improve the software so please ema |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 9. |
|
Braille Sense OnHand User Manual(Ver 6.0)_HIMS Braille Sense OnHand User Manual ENGLISH MANUAL For Software Version 6 0 April 2011 When there are any manual updates the readme files or appendices will be added to the manual CD and website HIMS Inc 4616 W Howard Lane Ste 960 Austin TX 78728 Phone 888 520 4467 Fax 512 837 2011 Email support hims inc com 1 Safety Precaution The input voltage of the AC adapter is 100V 240V and the output is DC 5V 2A When the Braille Sense OnHand is s |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 10. |
|
Broan 36 " Chimney RangeMaster 52000 RM523604 user manual BRBAN RM51000 RM52000 Series ENGLISH 2 FRANQAIS 13 ESPANOL 24 In USA BROAN Hartford Wisconsin In CANADA BROAN Drummondville QC Canada REGISTER YOUR PRODUCT ONLINE AT www Broan com register For additional Information visit www Broan com READ AND SAVE THESE INSTRUCTIONS A INTENDED FOR DOMESTIC COOKING ONLY A A A WARNING TO REDUCE THE RISK OF FIRE ELECTRIC SHOCK OR INJURY TO PERSONS OBSERVE THE FOLLOWING 1 Use this unit only in |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 11. |
|
Carcomm Cell Phone Accessories CMPC - 15 HTC Himalaya - Alpine / Qtek 2020 - 2020i user manual Mobile PDA Cradle r icorcommf CMPC l 5 HTC Himalaya Alpine Qtek 2020 2020i L Introduction This installation manual has been prepared to provide the basic information needed to install the CMPC 15 This manual is not intended to be definitive because there are different models and types of vehicles which will require different installation work The information given is for general guidance only The terms of warranty demand that this mobile PDA cradle is ins |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 12. |
|
Chimera 1860 user manual CHIMERA SMALL PANCAKE LANTERN ASSEMBLY INSTRUCTIONS Item numbers 1860 and 1864 WARNING FAILURE TO FOLLOW THESE SAFETY PRECAUTIONS COULD CREATE A HAZARDOUS CONDITION 1 This product is intended for use with bare bulb instruments pointed straight down Refer to the light manufacturer s recommendations before operating the light in this position 2 Do not leave unattended 3 Use the light s protective screen or shield at all times 4 Use in a moderate temperature enviro |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 13. |
|
Chimera 1864 user manual CHIMERA SMALL PANCAKE LANTERN ASSEMBLY INSTRUCTIONS Item numbers 1860 and 1864 WARNING FAILURE TO FOLLOW THESE SAFETY PRECAUTIONS COULD CREATE A HAZARDOUS CONDITION 1 This product is intended for use with bare bulb instruments pointed straight down Refer to the light manufacturer s recommendations before operating the light in this position 2 Do not leave unattended 3 Use the light s protective screen or shield at all times 4 Use in a moderate temperature enviro |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 14. |
|
Chimera 1880 user manual LANTERN ASSEMBLY INSTRUCTIONS Item numbers 1880 and 1885 WARNING FAILURE TO FOLLOW THESE SAFETY PRECAUTIONS COULD CREATE A HAZARDOUS CONDITION 1 This Chimera Lantern product is intended for use with shielded bulb instruments pointed straight down Refer to the light manufacturer s recommendations before operating your particular light in this position 2 Do not leave the Lantern unattended when the light is on 3 Use the light s protective screen or shield at all tim |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 15. |
|
Chimera 1885 user manual LANTERN ASSEMBLY INSTRUCTIONS Item numbers 1880 and 1885 WARNING FAILURE TO FOLLOW THESE SAFETY PRECAUTIONS COULD CREATE A HAZARDOUS CONDITION 1 This Chimera Lantern product is intended for use with shieided buib instruments pointed straight down Refer to the tight manufacturer s recommendations before operating your particuiar tight in this position 2 Do not ieave the Lantern unattended when the tight is on 3 Use the tight s protective screen or shietd at ait tim |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 16. |
|
Chimera 2785M user manual INSTRUCTIONS FOR 2785M SPEED RING CHIMERA PERFECT LIGHTING For use with the Canon EZ and EX Series and Nikon SB Series flash units This Speed Ring is used to mount two of the Canon EZ or EX or Nikon SB flash heads for use in a single Lightbank Note You will also need a multi flash cord to connect the flash units together and an off camera TTL cord to connect the flashes to your camera purchase from your flash dealer Instructions 1 Rotate the heads of both flash un |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 17. |
|
Chimera 8000 user manual 8000 8005 24 x 32 LIGHT KITS Instruction Sheet 8000E and 8005E Kits are 220 v PERFECT LIGHTING Thank you for purchasing your new CHIMERA Lightbank Kit We know you will enjoy working with CHIMERA quality lighting on all your projects IMPORTANT Please read the enclosed Lightbank Care and Use Instructions card for information on set up and take down of your Lightbank kit A seperate instruction sheet covers your new Triolet light 8000 500 WATT LIGHTBAN |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 18. |
|
Chimera 8005 user manual 8000 8005 24 X 32 LIGHT KITS Instruction Sheet 8000E and 8005E Kits are 220 v PERFECT LIGHTING Thank you for purchasing your new CHIMERA Lightbank Kit We know you will enjoy working with CHIMERA quality lighting on all your projects IMPORTANT Please read the enclosed Lightbank Care and Use Instructions card for information on set up and take down of your Lightbank kit A separate instruction sheet covers your new TrioletiM light 8000 500 WATT LIGHTBANK |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 19. |
|
Chimera 9500 user manual INSTRUCTIONS FOR SPEED RING 9500 Fits Lowel DP CAUTION THE DP SAFETY SCREEN MUST BE USED WITH THIS LIGHT FIXTURE SPEED RING COMBINATION Mounting the Speed Ring to the Light 1 Attach the safety screen to the DP light 2 Loosen all brass thumbscrews and remove all four capture plates 3 With the Speed Ring oriented so that the plates will be facing into the lightbank slide the Speed ring past the flange on the front of the light housing 4 Replace the capture plates |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 20. |
|
chimera e-learning platform user`s manual - ADAM Lifelong Learning Programme This project has been funded with support from the European Commission This publication reflects the views only of the author and the Commission cannot be held responsible for any use which may be made of the information contained therein Creative Holism to Improve Management and Entrepreneurial Role models and Approaches C H I M E R A E LEARNING PLATFORM USER S MANUAL by T ki ces UMIVERGITATESA fi Ne eS P Petru Malor SUPERFICI |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 21. |
|
CHIMERA User Manual Academic Environmental Health and Safety la California State University SS MONTEREY BAY Extraordinary Opportunity The Chemical Inventory Management amp Electronic Reporting Application CHIMERA Manual 4 Chemical Inventory Manual Table of Contents Introduction Getting Started Applying for Access Inventory Management 6 Adding 7 Updating 9 Deleting 11 Transferring 11 Editing CHIMERA Reports NFPA Sign Generator Inventory Search SDS |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 22. |
|
ChimerMarker User Manual SOFTGENETICS Copyright Licenses and Trademarks 2001 2012 Sof Genetics LLC All rights reserved No of this publication may be reproduced transmitted transcribed or translated into any language in any form by any means without the written permission of SoftGeneties LLC The software is copyrighted and cannot be altered or given toa third party without the writen authorization from SofiGenetics LLC The software may be licensed from Soft Genetics LLC Mutation |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 23. |
|
CHIMNEY HOOD USER MANUAL KITCHEN APPLIANCE SERIES RANGE HOOD INSTRUCTION MANUAL Read this manual carefully before using the appliance and store it in a safe place for future reference For authorized service amp original parts E RANGE HOOD NS Model H75 6P H75 7P H75 9P H75 10P 292 30 a 480 on _ 490 RANGE HOOD 11 Cleaning amp Maintenance Before cleaning Please confirm that the power 1s switched off 11 1 Cleaning the surface of hood |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 24. |
|
CHIMNEY HOOD USER MANUAL - No-IP KITCHEN APPLIANCE SERIES RANGE HOOD INSTRUCTION MANUAL Read this manual carefully before using the appliance and store itina safe place for future reference M RANGE HOOD WW Users Manual Content Model DZH339 I Notice daran 1 2 Feature neen ek EE REN REN RK nun nun unnnnn nun nun EE ann KEN EK nen 1 3 Installation 1 4 Change lamp 2 5 Notice of Installati |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 25. |
|
CHIMU Datasheet and User Manual(OLDER Om a CHIMU Micro AHRS User Manual CHIMU User Manual Rev D3 Table of Contents Contents ls INMOUCHON peer ence Ine eee etree er ee E ee ee iaopoa 4 1 1 it A te TEE 4 Ll lt lt 1 un opa 4 Ll2 Acceleration un UC 4 1 1 38 Magnetic field liMITS oocooccoocnconcconcconnconoconoconoconocononononononononononononanonanonanenanenanes 4 1 1 4 BIT and User Responsibility sese eee ee eee 4 1 2 Theory OF OD CT ANON ss 5 E WEE af OMG ION Sesso id o ias 5 1 |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 26. |
|
Front derailleur - SHIMANO Dealer`s Manual / User`s Manual English DM FD0003 04 Dealer s Manual Front derailleur FD M9000 FD M9020 FD M9025 FD M8000 FD M8020 FD M8025 FD M612 FD M617 FD M618 FD M672 FD M677 CONTENTS IMPORTANT NOTICE ccceceececeeeeeeeeceenseeeeeneneaeeseneueasaeeeeesueaseeeneesaeanens 3 TO ENSURE SAFETY a TS 4 INSTALLATION anne nn aan nn ac nr no once 6 ES TOP COGS tO De USO erase a ee ee a nn 6 Installation of the TON CRIRE ea eee ne een cn on 6 Installation of the front derailleur Fr |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 27. |
|
Front Hub (for Disc Brake) - SHIMANO Dealer`s Manual / User`s UM 28K0A 002 00 User s manual Front Hub for Disc Brake a User s manuals in other languages are available at N http si shimano com IMPORTANT NOTICE e Contact the place of purchase or a bicycle dealer for information on installation and adjustment of the products which are not found in the user s manual A dealer s manual for professional and experienced bicycle mechanics is available on our website http si shimano com e Do not disassemble o |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 28. |
|
Front Hub/Freehub(standard) - SHIMANO Dealer`s Manual / User`s English DM HB0002 06 Dealer s Manual Front Downhill Freeride Trekking HB M820 820 675 675 FH M825 HB M640 640 FH M645 HB M8000 FH M8000 FH M648 8010 FH M8010 Cross Country HB M9010 FH M9000 FH M9010 HB M675 HB M678 HB M615 HB M618 FH M675 FH M678 FH M615 FH M618 SM AX75 SM AX76 SM AX78 SM AX65 SM AX55 SM AX56 SM AX58 IMPORTANT NOTICE This dealer s manual |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 29. |
|
Heath Zenith Chime Extender 6157 user manual Chime Extender JCE Model 6157 This package includes Style of chime extender and chime may vary from illustration Wireless plug in chime Chime Extender Hardware pack The chime extender requires 4 AAA alkaline batteries not included Your ACE Chime Extender allows you to add doorbell coverage to any room in your house without the need to run additional wires The Chime Extender listens for your existing doorbell to ring then transmits |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 30. |
|
Heath Zenith Weatherproof Long Range Wireless Chime with Chime Extender AC-6507 user manual AC Model AC 6507 3196458 Weatherproof Long Range Wireless Chime with Chime Extender This package includes Style of transmitter and chime may vary from illustration Weatherproof Battery Operated Wireless Chime Extension Transmitter Hardware Pack NOTE This chime requires 3 D alkaline batteries for the chime and 4 AAA alkaline batteries for the transmitter Not Included Your ACE Chime Extender allows you to add doorbell coverage to anyw |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 31. |
|
Hydraulic Disc Brake - SHIMANO Dealer`s Manual / User`s Manual UM 8VTOA 000 00 User s manual Hydraulic Disc Brake for Downhill Freeride User s manuals in other languages are available at http si shimano com iMPORTANT NOTICE e Contact the place of purchase or a bicycle dealer for information on installation and adjustment of the products which are not found in the user s manual A dealer s manual for professional and experienced bicycle mechanics is available on our website http si shimano com e Do not |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 32. |
|
Jevtrace v3.12b User Manual Marcin Joachimiak 1/6/04 Jevtrace v3 12b amp jevtrace dendogram c jevtrace_test MLE_tcoffee ph lt c jevtrace_test MLE_tcoffee aln 30 40 50 MYKSVETILVDIPTIRPHKLSVTTMQTOTI Meme MIATGITIDRIDTLLVDVPTVRPHKLSVATMNCQ 7 MIATGITIDRIDTLLVDVPTVRPHKLSVATMNCQ MIATPVKIESVETILVDVPTIRPHRLSVATMNCQTTI MIATPVKIESVETILVELPTIRPHRLSVATMNCOTL MIATPVKIESVETILVDVPTIRPHRLSVATMNC OTL MIPSAVQIQAVETILVDVPTIRPHRLSVATMNC ne MTALANPOILGIETILLDLPTIRPHVLAMATMHAQT MNAOITSVETVLVDLPTIRAHQLAMATMQQQTI MNAQITSV |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 33. |
|
M&S Systems CHIME MC3 user manual INSTALLATION INSTRUCTIONS for Chime Models MC3 and MC8 NOTE These chimes are used with series DMC1 and DMC3 4 MASTER UNITS 1 Snap the Chime Board onto the 4 plastic standoffs in the wallhousing See figure 1 2 BEFORE APPLYING POWER TO MASTER UNIT plug chime connector into back of master unit at the location indicated by the printing on the circuit board 3 AFTER SYSTEM INSTALLATION IS COMPLETE apply power and adjust the chime volume to desired level The volume will incr |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 34. |
|
M&S Systems CHIME MC8 user manual INSTALLATION INSTRUCTIONS for Chime Models MC3 and MC8 NOTE These chimes are used with series DMC1 and DMC3 4 MASTER UNITS 1 Snap the Chime Board onto the 4 plastic standoffs in the wallhousing See figure 1 2 BEFORE APPLYING POWER TO MASTER UNIT plug chime connector into back of master unit at the location indicated by the printing on the circuit board 3 AFTER SYSTEM INSTALLATION IS COMPLETE apply power and adjust the chime volume to desired level The volume will incr |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 35. |
|
Rangemaster Chimney Hood user manual Libretto Istruzioni Instructions Manual Manuel d Instructions Bedienungsanleitung Gebruiksaanwijzing www rangemaster co uk INDICE CONSIGLIE SUGGERIMENTI 3 CARATTERISTICHE 4 INSTAEEAZIONE 5 USO 8 MANUTENZIONE 9 INDEX Bl RECOMMENDATIONS AND SUGGESTIONS 10 CHARACTERISTICS 11 INSTAEEATION 12 USE 15 MAINTENANCE 16 SOMMAIRE B l CONSEIES ETSUGGESTIONS 17 CARACTERISTIOUES 18 INSTAEEATION 19 UTIEISATION 22 ENTRETIEN 23 INHALTSVERZEICHNIS ES |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 36. |
|
Razer Chimaera 5.1 user manual mmm s i v ftp 5a UJITELE55 EaminE hEad5ET V The Razer Chimaera 5 1 Wireless Gaming Headset for Xbox 360 gives you a true to life surround sound experience Building on our extensive gaming audio expertise from PC gaming this wireless headset offers pinpoint tournament grade 5 1 positional audio with extra large circumaural ear cups for maximum comfort The base station doubles up as a charging dock and audio processing unit giving you the option to adjust the game |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 37. |
|
Rear Freehub (for E-Thru) - SHIMANO Dealer`s Manual / User`s UM 3TLOA 001 00 User s manual Rear Freehub for E Thru a User s manuals in other languages are available at N http si shimano com IMPORTANT NOTICE e Contact the place of purchase or a bicycle dealer for information on installation and adjustment of the products which are not found in the user s manual A dealer s manual for professional and experienced bicycle mechanics is available on our website http si shimano com e Do not disassemble or |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 38. |
|
SEOSHOP - MAILCHIMP APP INSTALLATION & USER MANUAL TAUROS MEDIA SEOSHOP MAILCHIMP APP V2 1 BETA TM TAUROS E A INSTALLATION USER MANUAL V2 1 JUNE 20 2015 BROUGHT TO YOU BY SEOSHOP GROUP B V KEIZERSGRACHT 313 1016EE AMSTERDAM THE NETHERLANDS INFO GETSEOSHOP COM DEVELOPED BY TAUROS MEDIA NEDERLAND B V POSTBUS 75035 1077 AA AMSTERDAM INFO TAUROSMEDIA COM UROS MEDIA USER MANUAL SEOSHOP MAILCHIMP APP V2 1 TAU |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 39. |
|
Shimano 200DC user manual To respect the environment SHIMANO uses recycled paper Please do not litter This is a recycleable paper product A Shimano usa papel reciclado em respeito ao meio ambiente Por favor mantenha a cidade limpa Este papel e reciclavel suimnno INSTRUCTION GUIDE MANUEL D INSTRUCTIONS CONGRATULATIONS You have chosen the superb quality and outstanding performance of a Shimano engineered product FELICITATIONS Vous avez choisi les performances exceptionnelles et la |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 40. |
|
Shimano 200SF user manual 30 no NOiion iSNi UUUIIHS uiequeg smmnno SMimnno nmeRicnn coRPORRTion One Holland Drive Irvine CA92618Tel 877 577 0600 snimnno cnnoDo ltd ltee 685 The Queensway Peterborough Ontario K9J 7J6 Tel 705 745 3232 SMimnno Europe Fisuino moldirg bv Industrieweg 24 8071 CT Nunspeet Holland Tel 31 0 341 272222 DUNPHY SPORTS FISHING IMPORTS PTY LTD SMimnno bustrrlir UNIT 1 1 3 ENDEAVOUR ROAD CARINGBAH N S W 2229 AUSTRALIATel 02 9526 2144 suimnno |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 41. |
|
Shimano 201DC user manual To respect the environment SHIMANO uses recycled paper Please do not litter This is a recycleable paper product A Shimano usa papel reciclado em respeito ao meio ambiente Por favor mantenha a cidade iimpa Este papel e reciclavel suimnno INSTRUCTION GUIDE MANUEL D lNSTRUCTIONS CONGRATULATIONS You have chosen the superb quality and outstanding performance of a Shimano engineered product FELICITATIONS Vous avez choisi les performances exceptionnelles et la |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 42. |
|
Shimano 201SF user manual 30 no NOiion iSNi UUUIIHS uiequeg smmnno SMimnno nmeRicnn coRPORRTion One Holland Drive Irvine CA92618Tel 877 577 0600 snimnno cnnoDo ltd ltee 685 The Queensway Peterborough Ontario K9J 7J6 Tel 705 745 3232 SMimnno Europe Fisuino moldirg bv Industrieweg 24 8071 CT Nunspeet Holland Tel 31 0 341 272222 DUNPHY SPORTS FISHING IMPORTS PTY LTD SMimnno bustrrlir UNIT 1 1 3 ENDEAVOUR ROAD CARINGBAH N S W 2229 AUSTRALIATel 02 9526 2144 suimnno |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 43. |
|
Shimano 20II user manual To respect the environment SHIMANO uses recycled paper Please do not litter This is a recycleable paper product suimnno INSTRUCTION GUIDE CONGRATULATIONS You have chosen the superb quality and outstanding performance of the Shimano TYRNOS lever drag reel When it comes to powerful smooth running drags nothing beats a lever drag The TYRNOS however unlike most lever drags which are made primarily for trolling is special It has been specifically designed t |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 44. |
|
Shimano 30II user manual To respect the environment SHIMANO uses recycled paper Please do not litter This is a recycleable paper product suimnno INSTRUCTION GUIDE CONGRATULATIONS You have chosen the superb quality and outstanding performance of the Shimano TYRNOS lever drag reel When it comes to powerful smooth running drags nothing beats a lever drag The TYRNOS however unlike most lever drags which are made primarily for trolling is special It has been specifically designed t |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 45. |
|
Shimano Alfine CT-S500 Chain Tensioner User Manual ALFINE Chain Tensioner CT S500 g TE EENS oesomieron RURE 1 Y 50D 98010 Fixing Bolt amp E Ring 2 Y 50D 15000 Shim 1 mm 3 Y 50D 15010 Shim 2 mm 4 Y 50D 16000 P Tension Spring 5 Y 5UC 14000 P Seal Ring A 6 Y 50D 98020 Outer Plate Assembly A 7 Y 5VM98060 Pulley Bolt M5 x 13 95 2 pcs A 8 Y 5TT 98020 Tension amp Guide Pulley Set A Y 50D 98040 Tension amp Guide Pulley Set for Black Spec 9 Y 53Z 08200 Inner Plate Silver |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 46. |
|
Shimano Altus SL-M310 Front Shifter 3sp User Manual Rapidfire Plus Lever 2 Finger For V BRAKE ST M31 O sro2 S Silver Version ST M31 O sro2 L Black Version For Left Hand For Right Hand vo oF S S g FS S Ta BANANO DESCRIPTION uoe 1 Y6UH98010 R H Indicator Unit B Y6UJ98010 L H Indicator Unit A 2 Y6UH98030 Reach Adjusting Screw M4 x 14 5 amp Spring 3 Y8UM98010 Brake Cable Adjusting Bolt amp Nut A 4 Y6PZ98070 Shifting Cable Adjusting Bolt Unit A 5 Y6CD33000 |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 47. |
|
Shimano Fishing Equipment user manual 3QIH9 NOLLDTmiSNI ouuuims filALOOl J DHVNOfcK suimnno suimnno nrneRicnn coRPORRTion One Holland Drive Irvine CA 92618 Tel 949 951 5003 suimnno con DR ltd ltee 685 The Queensway Peterborough Ontario K9J 7J6 Tel 705 745 3232 suimnno Europe FisumG woLDinc bv Industrieweg 24 8071 CT Nunspeet Holland Tel 31 0 341 272222 DUNPHY SPORTS FISHING IMPORTS PTY LTD isuimnno nusTRnuni UNIT5 32 ENDEAVOUR ROAD CARINGBAH N S W 2229 AUSTRALIA Tel 02 526 2144 s |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 48. |
|
Shimano Ultegra 6703 Crankset Triple User Manual ULTEGRA Front Chainwheel FC 6703 Silver Version FC 6703 c Glossy Grey Version e Bolt circle diameter 130 mm For outer gear and middle gear 92 mm For inner gear ITEM SHIMANO DESCRIPTION INTERCHANGE 1 Y1KS13000 Crank Arm Fixing Bolt A A Y1LJ98010 Left Hand Crank Arm 165 mm for FC 6703 A B B Y1LJ98110 Left Hand Crank Arm 165 mm for FC 6703 G A B B Y1LJ9802 |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 49. |
|
Shimano XT M785 Hydraulic Brake Lever User Manual DEORE XT Brake Lever B L M 785 For Disc Brake E e SFF x Y amp Ta SEMAN DESORPTION ee 1 Y8VC98010 Bleed Screw M5 x 4 7 amp O Ring B A PD Y8VC98050 Lid Fixing Bolt M3 2 pcs A A i 3 Y8VC04000 R H Lid B A Y8VC04010 L H Lid B A 4 Y8VC98060 Separator Unit A A 5 Y8VC05000 Lever Axle 5 6 Y8VC98020 Stroke Adjust Screw M4 x 12 amp Plate 7 Y8VC98030 R H Lever Member Unit Y8VC98040 L H Lever Member Un |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 50. |
|
SootEater RCH205 Rotary Chimney Cleaning System User Manual Gardus INC S60 t ater Rotary Chimney Cleaning System Operator s Manual EY Thank you for purchasing the Sot Eater Rotary Chimney Cleaning System Please follow the important safeguards and operating instructions included within this manual before operating the system It may be necessary to reference additional publications to provide further safety and operating procedures W The S otEater System Includes 1 Chimney Whip 6 3 Long Flexible 1 |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 51. |
|
SVG301S SIP ATA User manual - CHIMA TELECOM CO.,LIMITED onma B SVG301S 2 FXS SIP ATA User Manual SVG301S 2 FXS 4 LAN 1 WAN SIP ATA User Guide Stephen Technologies Co Limited www stephen tele com CHIM Con 3 SVG301S 2 FXS SIP ATA User Manual CONTENT 1 Introducing ATA 3 1 1 Hardware Overview 3 1 2 Interface Description 3 2 Installing ATA 3 3 Configuration Guide 3 3 1 Configuration with Web Browser 3 3 2 Configuration with analog telephone 3 4 ATA Setup Menu 4 4 1 Current configurations 4 4 2 Basic configurati |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 52. |
|
User Manual - ihiMall.com ihi Biuetootn FM Transmitter Model IHB258 User Manual Contents Product Diagram asec sricaiteseisaaasaunicsacehactinien ties auateibesattatisehaniaageeiadees 2 OMER STUT reer a E E a e 3 Operating Instructions Installing thiBluetooth in your vehicle 3 Pairing your mobile Bluetooth device to the thiBluetooth 4 Playing TIS IG sco casatacacttanics iancassan ae aneapianatanchietiacasenesenentianaaphagadagancntens 4 Making Hands Free Calls sccxtarapecarcrnsasiiea |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 53. |
|
User Manual for HiModel COOL Series ESC User Manual for HiModel COOL Series ESC Thank you for purchasing our products For the high power of this brushless system failure to use may result in injury yourself and damage of the whole device So we highly recommend you to read carefully and abide by the operating procedures of this manual before the first flight SunRise is not responsible for your misuse of this product or any damage including incidental losses or indirect losses you may cause Moreover we have not any res |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 54. |
|
User Manual for PatchImportance 1.0: Quantifying Relative Habitat User Manual for PatchImportance 1 0 Quantifying Relative Habitat Patch Importance Based on Metapopulation Persistence and Minimum Abundance M H Grinnell and J M R Curtis Fisheries and Oceans Canada Science Branch Pacific Region Pacific Biological Station 3190 Hammond Bay Road Nanaimo BC V9T 6N7 2012 Canadian Technical Report of Fisheries and Aquatic Sciences 2977 Fisheries and Oceans P ches et Oc ans il LH fe i Canada Canada Canada Canadian Technical Re |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 55. |
|
User Manual of HiModel 5A HV UBEC User Manual of HiModel 5A HV UBEC 5 Amps High Voltage Switch Mode UBEC 1 Why do you need a high voltage UBEC The 5A HV UBEC is a switch mode DC DC regulator supplied with a 3 10 cells lithium battery pack and outputs a consistent safe power for your receiver gyro and servos It is very suitable for big electric RC models such as fixed wing aircrafts and helicopters above 4 cells lithium battery Using this UBEC the receiver can obtain the power supply directly from the mai |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 56. |
|
USER`S MANUAL - Yoshimasa USA Inc. USER S MANUAL YOSHIMASA SUSHI DISPLAY CASE INCLUDING REFRIGERATED NON REFRIGERATED UNITS YOSHIMASA USA INC 2730 Monterey St 103 Torrance CA 90503 USA Tel 310 533 1111 800 789 9835 Fax 310 533 1117 800 789 9836 www YOSHIMASAusa com info YOSHIMASAusa com 4N WARNING DO NOT block the AIR WAY of the condensing unit or it generates heat and causes severe compressor damages DO NOT BLOCK AIR INLET OUTLET AREA Let warm air c |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 57. |
|
User`s Manual for HIMOS Series DITEL 6 User s Manual for HIMOS Series www ditel es COPYRIGHT NOTICE This manual is a publication of Ditel and is provided for use by its customers only The contents of the manual are copyrighted by Ditel reproduction in whole or in part for use other than in support of Ditel equipment is prohibited without the specific written permission of Ditel SERVICE If service is required then pack the unit in its original packaging container or if unavailable any sui |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 58. |
|
Voice Sense QWERTY User Manual (Ver 6.0)_HIMS Voice Sense QWERTY User Manual ENGLISH MANUAL For Software Version 6 0 April 2011 When there are any manual updates the readme files or appendices will be added to the manual CD and website HIMS Inc 4616 W Howard Lane Ste 960 Austin TX 78728 Phone 888 520 4467 Fax 512 837 2011 Email support hims inc com Safety Precautions For your safety from the Voice Sense QWERTY please read safety precautions carefully 1 2 The input voltage of the AC |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 59. |
|
Voice Sense User Manual(Ver 6.0)_HIMS Voice Sense User Manual ENGLISH MANUAL For Software Version 6 0 April 2011 When there are any manual updates the readme files or appendices will be added to the manual CD and website HIMS Inc 4616 W Howard Lane Ste 960 Austin TX 78728 Phone 888 520 4467 Fax 512 837 2011 Email support hims inc com Safety Precautions For your safety from the Voice Sense please read safety precautions carefully 1 The input voltage of the AC adapter is 100V 240V |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 60. |
|
Waterford Precision Cycles Chimney Hood user manual An AGA Company 60 70 I 90cm Stainless Steel Chimney Hoods To be installed by a trained and competent person INSTALLATION amp OPERATING MANUAL To be left with end user WARNING amp SAFETY INFORMATION Please read this manual carefully it provides important information about the safety installation use and main tenance of the appliance The manufacturer cannot be considered responsible for any damage caused by improper incorrect or unreasonable use WARNING |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 61. |
|
Wireless Door Chime User`s Manual 46 19230 2 Wireless Door Chime User s Manual Chime Push Button Thank you on your purchase of the Wireless Door Chime Before installation please read this manual carefully and keep for future reference 5m Reguired Tools e Flathead screwdriver e Drill e 1 16 drill bit e 5 32 drill bit e Phillips screwdriver Included Hardware e 2 Plastic anchors e 4 Screws e 1 Double sided Tape e 1 12 Volt battery Battery Installation Chime Uni |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 62. |
|
Wolf Appliance Company Pro 36" (914) Wall Chimney Hood PWC362418 user manual LJOI pf anning Information Pro 36 914 Wall Chimney Hood MODEL PWC36241 8 R Model PWC362418 Model PWC362418R Rail Option Hand finished craftsmanship Classic stainless steel finish Welded seams and hemmed edges blower control Model PWC362418R shown with decorative rail Wolf Pro wall chimney hoods are available in the classic stainless steel finish Rail option hoods R come with a classic stainless steel decorative rail and stand offs Optio |
PDF Manual | ENGLISH |
![]() |
|||||||||
| 63. |
|
[Himbox-HB01] Bluetooth Hands-Free Car Kit User Manual This Himbox HB01 Bluetooth Hands Free Car Kit User Manual This Himbox Bluetooth car kit is developed for easy installation in motor vehicles to enable hands free operation of mobile phones and use of individual features With this kit you can use the car stereo to relish the music saved in your cell phone and answer incoming calls without having to pick up your phone As a big bonus this car kit is equipped with dual USB ports so while it is working you can have a digital device j |
PDF Manual | ENGLISH |
![]() |
|||||||||
| ☆ | Vermont Casting 4040 - 4046 user manual | Manual | ENGLISH | [Download] |
| ☆ | United States Stove G9740L user manual | Manual | ENGLISH | [Download] |
| ☆ | Vanguard Heating VN1800TB user manual | Manual | ENGLISH | [Download] |
| ☆ | Vermont Casting 4085 - 4087 user manual | Manual | ENGLISH | [Download] |
| ☆ | Vermont Casting 2479 user manual | Manual | ENGLISH | [Download] |
| ☆ | Vermont Casting RDVOD 3354 user manual | Manual | ENGLISH | [Download] |
| ☆ | Vermont Casting 3370 user manual | Manual | ENGLISH | [Download] |
| ☆ | Vermont Casting Non-Catalytic Convection Heater 2478CE user manual | Manual | ENGLISH | [Download] |
| ☆ | Vermont Casting 4090 - 4092 user manual | Manual | ENGLISH | [Download] |
| ☆ | Vanguard Managed Solutions Flame-Max Golden Oak Log Design user manual | Manual | ENGLISH | [Download] |
| ☆ | Vermont Casting 4030 - 4036 user manual | Manual | ENGLISH | [Download] |
| ☆ | Vermont Casting RDVOD 3369 user manual | Manual | ENGLISH | [Download] |
| ☆ | Vanguard Managed Solutions NLFB32NC user manual | Manual | ENGLISH | [Download] |
| ☆ | Vermont Casting RDVOD 3360 user manual | Manual | ENGLISH | [Download] |
| ☆ | Vermont Casting Jefferson JUVSR & JUVSM 3095, 3096, 3097, 3100, 3101, 3102, 3105, 3106, 3107, 3110, 3111, 3112 user manual | Manual | ENGLISH | [Download] |
| ☆ | Vermont Casting RDVOD 3390 user manual | Manual | ENGLISH | [Download] |
| ☆ | Vermont Casting RDVOD 3350 user manual | Manual | ENGLISH | [Download] |
| ☆ | Vermont Casting RUVS40 user manual | Manual | ENGLISH | [Download] |
| ☆ | Vanguard Managed Solutions Flame-Max Vintage Oak Log Design user manual | Manual | ENGLISH | [Download] |
| ☆ | Vermont Casting RDVOD 3399 user manual | Manual | ENGLISH | [Download] |